PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV47127.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family ARF
Protein Properties Length: 1053aa    MW: 117567 Da    PI: 6.6183
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV47127.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.79.3e-23126227199
                 EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                 f+k lt sd++++g +++p++ ae++       + +++  ++l+ +d++ ++W++++iyr++++r++lt+GW+ Fv++++L +gD v+F   ++++ +l
  KZV47127.1 126 FCKNLTASDTSTHGGFSVPRRAAEKIfptldfsM-QPPA-QELSARDLHDQTWTFRHIYRGQPKRHLLTTGWSVFVSSKRLIAGDAVLFI--RDEKSQL 220
                 89*****************************954.4444.49************************************************..4567778 PP

                 EEEEE-S CS
          B3  93 vvkvfrk 99 
                 +++++r+
  KZV47127.1 221 LLGIRRA 227
                 9999997 PP

2Auxin_resp121.75.4e-40252334183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 aahaa+++s F+v+YnPras+seFv++++k++ka++++vs+GmRf+m+fete+s  rr++Gtv+g+sdld++rW+nS+Wr+L+
  KZV47127.1 252 AAHAAANNSSFTVFYNPRASPSEFVIPLAKYNKAMYSQVSPGMRFRMMFETEESGVRRYMGTVTGISDLDSLRWKNSQWRNLQ 334
                 79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.29E-43115255IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.2E-41119241IPR015300DNA-binding pseudobarrel domain
CDDcd100171.36E-19125226No hitNo description
SMARTSM010198.1E-22126228IPR003340B3 DNA binding domain
PROSITE profilePS5086312.252126228IPR003340B3 DNA binding domain
PfamPF023621.6E-20126227IPR003340B3 DNA binding domain
PfamPF065073.2E-35252334IPR010525Auxin response factor
PfamPF023092.8E-99241012IPR033389AUX/IAA domain
PROSITE profilePS5174525.8839261019IPR000270PB1 domain
SuperFamilySSF542774.12E-99281004No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0010311Biological Processlateral root formation
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 1053 aa     Download sequence    Send to blast
MKIPSGGFVT NSGEGDKKMI NSELWHACAG PLVALPPVGS LVVYFPQGHS EQVAASMQKD  60
TDSIPSYPNL PSKLICMLHD VTLHADVETD EVYAQMTLQP VNKYDHEALL VSDIGLKHNR  120
QPAEFFCKNL TASDTSTHGG FSVPRRAAEK IFPTLDFSMQ PPAQELSARD LHDQTWTFRH  180
IYRGQPKRHL LTTGWSVFVS SKRLIAGDAV LFIRDEKSQL LLGIRRANRQ QPALSSSVIS  240
SDSMHIGILA AAAHAAANNS SFTVFYNPRA SPSEFVIPLA KYNKAMYSQV SPGMRFRMMF  300
ETEESGVRRY MGTVTGISDL DSLRWKNSQW RNLQVGWDES TAGERPSRVS IWEVEPVVTP  360
FYICPPPFFR PKFPKNPSFP DDDIGMENIF KRGLPWLADD FSITDASSSI FPGLSLVQWM  420
SMQQNNQLSS NQSGLFPNSS VLQGNLGTDD HTKLLNFQNP SFAAHNLTPG KGNIPNLQVG  480
QQQMQQMLQS PANTLQPQPR PQLPLQQTQP QLLQQTLQQL QQQRLPQPPV LLPPVTNGVT  540
LDQATNQNSH QIGVYPQVQQ QQILTRNVHL QQNDPLVNIT TFPVTTMTQD MVFPQPVEQQ  600
SSLLQRPQQQ QLQLQQTPLP MLQQQKPQML QFSQQMQFQL LQKLQQQQQQ PQLQSPLNPL  660
LEAQCPQKQQ LQQSQQPQNL CLPPKASMST LPGSSSVQSP QFPTNQIQHK SPLENIRSRV  720
EGDDPSCSTS PSKTSFQASQ SNFFNRYQTG PSTLLDNTTI HRTINLAQET HTKIDNRMKH  780
EFPNYKPTEQ PKFKGAANDR LDAASTATSY CQDTGNLQQN FPLTGLETDV QSHTQNSLPF  840
AGNIDGLAPD ALLSRGYDSG KDMQNLLSNY SGTPRDIDTD LSSGINSQLL GMSNVSFKPG  900
CSNEVAINES AVLNGGLWSN QAPRMRTYAK VQKRGSVGRT VDVTRYKGYD ELRHDLARMF  960
GIEGLLEDPQ RTEWKLVYVD HENDILLVGD DPWEEFVSCV QSIKILSSAE VQQMSLDGDL  1020
GQMPMANQAC STTDSGNPWR GQYDNNSATS FNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1661735548388Auxin response factor 5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011093873.10.0PREDICTED: auxin response factor 19
TrEMBLA0A0D9VC450.0A0A0D9VC45_9ORYZ; Auxin response factor
STRINGPGSC0003DMT4000355920.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13022465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19